(data stored in ACNUC7421 zone)

EMBL: AP011115.PRCA

AP011115.PRCA        Location/Qualifiers
FT   CDS             complement(599747..600526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prcA"
FT                   /locus_tag="ROP_05810"
FT                   /product="20S proteasome alpha-type subunit"
FT                   /EC_number="3.4.25.1"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05810"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48828"
FT                   /db_xref="GOA:C1ASP6"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022296"
FT                   /db_xref="InterPro:IPR023332"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1ASP6"
FT                   /protein_id="BAH48828.1"
FT                   /translation="MTMPYYASAEQIMRDRSELARKGIARGRSVVVLTFRDGVLFVAEN
FT                   PSTALHKVSELYDRLGFAAVGKYNEFENLRRAGIVHADMRGYSYDRRDVTGRSLANAYA
FT                   QTLGTIFTEQPKPYEVEICVAEVGRVGSPKAPQLYRITYDGSIVDEQHFVVMGGTTEPI
FT                   ATAMRESYRADLDLEAAVGIAVNALRQGGAGEGEKRNVDVASLEVAVLDQSRPRRAFRR
FT                   IAGAALEQLVPAAPAAASESAPEPKPDTETKPADPQD"
     MTMPYYASAE QIMRDRSELA RKGIARGRSV VVLTFRDGVL FVAENPSTAL HKVSELYDRL        60
     GFAAVGKYNE FENLRRAGIV HADMRGYSYD RRDVTGRSLA NAYAQTLGTI FTEQPKPYEV       120
     EICVAEVGRV GSPKAPQLYR ITYDGSIVDE QHFVVMGGTT EPIATAMRES YRADLDLEAA       180
     VGIAVNALRQ GGAGEGEKRN VDVASLEVAV LDQSRPRRAF RRIAGAALEQ LVPAAPAAAS       240
     ESAPEPKPDT ETKPADPQD                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page