(data stored in ACNUC7421 zone)

EMBL: AP011115.PRCB

AP011115.PRCB        Location/Qualifiers
FT   CDS             complement(600523..601407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prcB"
FT                   /locus_tag="ROP_05820"
FT                   /product="20S proteasome beta-type subunit"
FT                   /EC_number="3.4.25.1"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05820"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48829"
FT                   /db_xref="GOA:C1ASP7"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022483"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1ASP7"
FT                   /protein_id="BAH48829.1"
FT                   /translation="MTADRPALRTGDGDTRLSFGSNLSSFTEYLRGHAPELLPENRIGH
FT                   RSHSTRGGDGMESGDLAPHGTTIVALTYKGGVLLAGDRRATQGNLIASRDVEKVYVTDE
FT                   YSAAGIAGTAGIAIELVRLFAVELEHYEKIEGVPLTFDGKANRLASMVRGNLGAAMQGL
FT                   AVVPLLVGYDLDADEEARAGRIVSYDVVGGRYEERAGYHAVGSGSLFAKSALKKIYSPD
FT                   SDEETALRAAIESLYDAADDDSATGGPDLTRGIYPTAVTITQAGAVHVSEETTSELARR
FT                   IVAERTEEGGSAR"
     MTADRPALRT GDGDTRLSFG SNLSSFTEYL RGHAPELLPE NRIGHRSHST RGGDGMESGD        60
     LAPHGTTIVA LTYKGGVLLA GDRRATQGNL IASRDVEKVY VTDEYSAAGI AGTAGIAIEL       120
     VRLFAVELEH YEKIEGVPLT FDGKANRLAS MVRGNLGAAM QGLAVVPLLV GYDLDADEEA       180
     RAGRIVSYDV VGGRYEERAG YHAVGSGSLF AKSALKKIYS PDSDEETALR AAIESLYDAA       240
     DDDSATGGPD LTRGIYPTAV TITQAGAVHV SEETTSELAR RIVAERTEEG GSAR             294
//

If you have problems or comments...

PBIL Back to PBIL home page