(data stored in ACNUC7421 zone)

EMBL: AP011115.PRPA

AP011115.PRPA        Location/Qualifiers
FT   CDS             501155..503692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpA"
FT                   /locus_tag="ROP_04920"
FT                   /product="serine/threonine protein phosphatase PrpA"
FT                   /EC_number="3.1.3.16"
FT                   /note="protein synonym:phosphoprotein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04920"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48739"
FT                   /db_xref="GOA:C1ARR2"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR024028"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR032380"
FT                   /db_xref="InterPro:IPR032390"
FT                   /db_xref="InterPro:IPR041780"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARR2"
FT                   /protein_id="BAH48739.1"
FT                   /translation="MTDISVPALSLVVLVGVSGSGKSSFAAQHFAPTQVLSSDFCRGLV
FT                   ADDENDQSATSDAFDVLLYIAGTRLRRGLLTVVDATNVQREARKALVDLAKSHDVLVDA
FT                   IVIDVPDDVAIARNATRPDRDFGPHVIRRQHKDLRRSLPKLGREGFRRVHVLTGVEAID
FT                   SATVSIEKAWTDKRDLTGPFDIIGDVHGCRSELETLLRELGWQLQPDGAGAHHPEGRTA
FT                   VFVGDLVDRGPDTPGVLRLVMGMVAAGTALCVSGNHEQKLSRALHGRNVTTSHGLQASL
FT                   DQLAAESDDFRKSAHAFIDGLISHYELDGGNLVVAHAGLKEAYHGRASARVRSFALYGD
FT                   TTGETDEYGLPVRYPWAHDYRGRAFVVYGHTPVPETEWINNTICLDTGVVFGGRLTALR
FT                   YPGKDIVSVPAEQVWFEPARPLDTASARPGHRTQRDPTLLSIDDVRGTRHIDVRYNKGR
FT                   IKVREENAAAALEIMSRFAVDPRWLVYLPPTMAPPATSNLDGYLEHPVQAFAEFAAAGV
FT                   GEVVCEEKHMGSRAIAVVARDAATAAERFGVTDGSSGIVYTRTGRPFFDDPATMSELVA
FT                   RLRTACTPLMDDLGSSWLALDCELLPWSAKAGELIRTQYASVGAAAGAALPDAITALER
FT                   AAARGLDVADLLTHNRTREANARLFREAYARYCWPVTGLDGVRLAPFQILACEGRATAV
FT                   TEPHSWHLAKLATLDDPLVAGTRHQFVDLTSDESRHAATTWWSQLTDAGGEGMVVKPLG
FT                   PTPAELAHRRIQPGIKVRGREYLRIIYGPDYTENLDVLRDRSLGRKRSMALREHALGLE
FT                   ALTRLTEGDPLWRVHETVFAVLALESEPVDPRL"
     MTDISVPALS LVVLVGVSGS GKSSFAAQHF APTQVLSSDF CRGLVADDEN DQSATSDAFD        60
     VLLYIAGTRL RRGLLTVVDA TNVQREARKA LVDLAKSHDV LVDAIVIDVP DDVAIARNAT       120
     RPDRDFGPHV IRRQHKDLRR SLPKLGREGF RRVHVLTGVE AIDSATVSIE KAWTDKRDLT       180
     GPFDIIGDVH GCRSELETLL RELGWQLQPD GAGAHHPEGR TAVFVGDLVD RGPDTPGVLR       240
     LVMGMVAAGT ALCVSGNHEQ KLSRALHGRN VTTSHGLQAS LDQLAAESDD FRKSAHAFID       300
     GLISHYELDG GNLVVAHAGL KEAYHGRASA RVRSFALYGD TTGETDEYGL PVRYPWAHDY       360
     RGRAFVVYGH TPVPETEWIN NTICLDTGVV FGGRLTALRY PGKDIVSVPA EQVWFEPARP       420
     LDTASARPGH RTQRDPTLLS IDDVRGTRHI DVRYNKGRIK VREENAAAAL EIMSRFAVDP       480
     RWLVYLPPTM APPATSNLDG YLEHPVQAFA EFAAAGVGEV VCEEKHMGSR AIAVVARDAA       540
     TAAERFGVTD GSSGIVYTRT GRPFFDDPAT MSELVARLRT ACTPLMDDLG SSWLALDCEL       600
     LPWSAKAGEL IRTQYASVGA AAGAALPDAI TALERAAARG LDVADLLTHN RTREANARLF       660
     REAYARYCWP VTGLDGVRLA PFQILACEGR ATAVTEPHSW HLAKLATLDD PLVAGTRHQF       720
     VDLTSDESRH AATTWWSQLT DAGGEGMVVK PLGPTPAELA HRRIQPGIKV RGREYLRIIY       780
     GPDYTENLDV LRDRSLGRKR SMALREHALG LEALTRLTEG DPLWRVHETV FAVLALESEP       840
     VDPRL                                                                   845
//

If you have problems or comments...

PBIL Back to PBIL home page