(data stored in ACNUC7421 zone)

EMBL: AP011115.PYK

AP011115.PYK         Location/Qualifiers
FT   CDS             complement(766677..768095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyk"
FT                   /locus_tag="ROP_07330"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07330"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48980"
FT                   /db_xref="GOA:C1AT48"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018209"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT48"
FT                   /protein_id="BAH48980.1"
FT                   /translation="MNRRTKIVCTLGPATATGDRIRELVESGMDVARLNFSHGEHADHE
FT                   ENYKRVRAASDATGKAVGVLADLQGPKIRLGRFAEGRTTWANGEEVRITVEECEGTHDR
FT                   VSTTYKQLAEDAKPGDRLLVDDGKVGLVVSGVEGNDVICRVTEGGPVSNNKGVSLPGMN
FT                   VSVPALSEKDIADLEFALGLGVDFIALSFVRSPADVELVHAVMDRVGRRIPVIAKLEKP
FT                   EAIDNLEAIVLAFDAVMVARGDLGVELPLEQVPLVQKRAIQIARENAKPVIVATQMLES
FT                   MIENSRPTRAEASDVANAVLDGADAVMLSGETSVGKYVMETVRTMARIVEAVENESTQV
FT                   PPLTHVPRTKRGVISYAARDIGERLDAKALVAFTQSGDTVRRLARLHTPLPLLAFTPLP
FT                   EVRSQLSLTWGTETFIVDPVDSTDAMVRQVDNALLGLGRYQKGELVVIVAGSPPGTVGS
FT                   TNLIHVHRIGEEDH"
     MNRRTKIVCT LGPATATGDR IRELVESGMD VARLNFSHGE HADHEENYKR VRAASDATGK        60
     AVGVLADLQG PKIRLGRFAE GRTTWANGEE VRITVEECEG THDRVSTTYK QLAEDAKPGD       120
     RLLVDDGKVG LVVSGVEGND VICRVTEGGP VSNNKGVSLP GMNVSVPALS EKDIADLEFA       180
     LGLGVDFIAL SFVRSPADVE LVHAVMDRVG RRIPVIAKLE KPEAIDNLEA IVLAFDAVMV       240
     ARGDLGVELP LEQVPLVQKR AIQIARENAK PVIVATQMLE SMIENSRPTR AEASDVANAV       300
     LDGADAVMLS GETSVGKYVM ETVRTMARIV EAVENESTQV PPLTHVPRTK RGVISYAARD       360
     IGERLDAKAL VAFTQSGDTV RRLARLHTPL PLLAFTPLPE VRSQLSLTWG TETFIVDPVD       420
     STDAMVRQVD NALLGLGRYQ KGELVVIVAG SPPGTVGSTN LIHVHRIGEE DH               472
//

If you have problems or comments...

PBIL Back to PBIL home page