(data stored in ACNUC7421 zone)

EMBL: AP011115.PYRG

AP011115.PYRG        Location/Qualifiers
FT   CDS             complement(686308..688077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrG"
FT                   /locus_tag="ROP_06640"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /note="protein synonym:UTP--ammonia ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06640"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48911"
FT                   /db_xref="GOA:C1ASX9"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1ASX9"
FT                   /protein_id="BAH48911.1"
FT                   /translation="MPQSRTHSRTATKHIFVSGGVASSLGKGLTASSLGQLLTARGMRV
FT                   TMQKLDPYLNVDPGTMNPFQHGEVFVTEDGAETDLDVGHYERFLDRDLSGQANVTTGQV
FT                   YSTVIAKERRGEYLGDTVQVIPHITDEIKSRILAMSGPDLQGHRPDVVITEIGGTVGDI
FT                   ESQPFLEAARQVRHDVGRDNVFFLHVSLVPYLAPSGELKTKPTQHSVAALRNIGIQPDA
FT                   LILRCDREVPPALKNKIALMCDVDVDGCISTPDAPSIYDIPKVLHSEGLDAYVVRQLGL
FT                   PFRDVDWTVWGNLLERVHQPRETVRIALVGKYVDLPDAYLSVTEALRAGGFANRSKVEI
FT                   SWVPSDACETEAGAQAALGDVDGVLIPGGFGIRGIEGKLGAIRYARHRKTPLLGLCLGL
FT                   QCVVIEAARSVGLDDANSAEFEPETTHPVISTMADQEDVIAGEADLGGTMRLGAYPAVL
FT                   AKGSVVARAYGSEEVSERHRHRYEVNNAYRDRIAKSGLRFSGTSPDGHLVEFVEYPADQ
FT                   HPFFVATQAHPELKSRPTRPHPLFAAFVDAALRHKLEERLPVDVHGEERAAADDEIAES
FT                   ADRDEVASVDSAG"
     MPQSRTHSRT ATKHIFVSGG VASSLGKGLT ASSLGQLLTA RGMRVTMQKL DPYLNVDPGT        60
     MNPFQHGEVF VTEDGAETDL DVGHYERFLD RDLSGQANVT TGQVYSTVIA KERRGEYLGD       120
     TVQVIPHITD EIKSRILAMS GPDLQGHRPD VVITEIGGTV GDIESQPFLE AARQVRHDVG       180
     RDNVFFLHVS LVPYLAPSGE LKTKPTQHSV AALRNIGIQP DALILRCDRE VPPALKNKIA       240
     LMCDVDVDGC ISTPDAPSIY DIPKVLHSEG LDAYVVRQLG LPFRDVDWTV WGNLLERVHQ       300
     PRETVRIALV GKYVDLPDAY LSVTEALRAG GFANRSKVEI SWVPSDACET EAGAQAALGD       360
     VDGVLIPGGF GIRGIEGKLG AIRYARHRKT PLLGLCLGLQ CVVIEAARSV GLDDANSAEF       420
     EPETTHPVIS TMADQEDVIA GEADLGGTMR LGAYPAVLAK GSVVARAYGS EEVSERHRHR       480
     YEVNNAYRDR IAKSGLRFSG TSPDGHLVEF VEYPADQHPF FVATQAHPEL KSRPTRPHPL       540
     FAAFVDAALR HKLEERLPVD VHGEERAAAD DEIAESADRD EVASVDSAG                   589
//

If you have problems or comments...

PBIL Back to PBIL home page