(data stored in ACNUC7421 zone)

EMBL: AP011115.RECN

AP011115.RECN        Location/Qualifiers
FT   CDS             complement(690459..692231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recN"
FT                   /locus_tag="ROP_06670"
FT                   /product="DNA repair protein RecN"
FT                   /note="protein synonym:recombination protein N"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06670"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48914"
FT                   /db_xref="GOA:C1ASY2"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR004604"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASY2"
FT                   /protein_id="BAH48914.1"
FT                   /translation="MLAEIRIDNLGVISEASAQFHEGLTVLTGETGAGKTMVVTSLHLL
FT                   SGARADAGRVRLGAPRAVVEGRFMTDEGSEHVERAVSRLLESTGAERDEDGTIIAVRTV
FT                   GSDGRSRAHLGGRSVPAGVLSEFTDPLLTVHGQNDQLRLLRPDQQCAALDRFADKTVGP
FT                   LVARYRKHRNEWMTARSELIERTGRTRELAQEADQLTFALNEIDGVAPTPGEDEAIVSE
FT                   VRRLSELDSLRSAAEEAHAALAGGDVMDGDGGAAPALDLLSEARARIESATDPELDGLG
FT                   PRLADAIAVVTDVSADLTTYLAGLPADPGALDSLLSRQAELKNLIRKYAADVDGVLEWA
FT                   DNARARLEKIDVSSDALAALTKQVEESAASTAEAASKLTAARVKAATKLAKAVSSELAG
FT                   LAMGRAALEVTVRPRIAGPQDTAPLTVDGTELHAGSSGVDEVEFRLSAHSGAQSLPISK
FT                   SASGGELSRVMLALEVVLAGSDSGATMVFDEVDAGVGGRAAVEIGRRLARLARTHQVIV
FT                   VTHLPQVAAFADTHLVVDKVDDQDGVVSSGVHTLTDDERVVELARMLAGLDDTETGRAH
FT                   AEELLATASAERSA"
     MLAEIRIDNL GVISEASAQF HEGLTVLTGE TGAGKTMVVT SLHLLSGARA DAGRVRLGAP        60
     RAVVEGRFMT DEGSEHVERA VSRLLESTGA ERDEDGTIIA VRTVGSDGRS RAHLGGRSVP       120
     AGVLSEFTDP LLTVHGQNDQ LRLLRPDQQC AALDRFADKT VGPLVARYRK HRNEWMTARS       180
     ELIERTGRTR ELAQEADQLT FALNEIDGVA PTPGEDEAIV SEVRRLSELD SLRSAAEEAH       240
     AALAGGDVMD GDGGAAPALD LLSEARARIE SATDPELDGL GPRLADAIAV VTDVSADLTT       300
     YLAGLPADPG ALDSLLSRQA ELKNLIRKYA ADVDGVLEWA DNARARLEKI DVSSDALAAL       360
     TKQVEESAAS TAEAASKLTA ARVKAATKLA KAVSSELAGL AMGRAALEVT VRPRIAGPQD       420
     TAPLTVDGTE LHAGSSGVDE VEFRLSAHSG AQSLPISKSA SGGELSRVML ALEVVLAGSD       480
     SGATMVFDEV DAGVGGRAAV EIGRRLARLA RTHQVIVVTH LPQVAAFADT HLVVDKVDDQ       540
     DGVVSSGVHT LTDDERVVEL ARMLAGLDDT ETGRAHAEEL LATASAERSA                  590
//

If you have problems or comments...

PBIL Back to PBIL home page