(data stored in ACNUC7421 zone)

EMBL: AP011115.RPIA

AP011115.RPIA        Location/Qualifiers
FT   CDS             complement(506937..507695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpiA"
FT                   /locus_tag="ROP_04970"
FT                   /product="ribose-5-phosphate isomerase A"
FT                   /EC_number="5.3.1.6"
FT                   /note="protein synonym:phosphoriboisomerase A"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04970"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48744"
FT                   /db_xref="GOA:C1ARR7"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARR7"
FT                   /protein_id="BAH48744.1"
FT                   /translation="MYTTETPQDAAKYAVGRAAVERYAHDGAQLGLGSGTTSAWFVRAL
FT                   GEKVAEGLDIVGVPTSTATRDLALSVGITLIDLNDLDRPLDVTLDGPDEVDHDGDMIKG
FT                   GGACLLWERMVAEASLKMVCIADDTKLVERLGSFPLPIEVIPFGWKATRRSISALFRDL
FT                   GYTDIDIVQRQRDGQPVVTDSGNFILDAHMVAITDKALLDTNLNWIAGVVENGLFTGIA
FT                   HEILIASPDGAAKLIELPHRRAARIPQWRK"
     MYTTETPQDA AKYAVGRAAV ERYAHDGAQL GLGSGTTSAW FVRALGEKVA EGLDIVGVPT        60
     STATRDLALS VGITLIDLND LDRPLDVTLD GPDEVDHDGD MIKGGGACLL WERMVAEASL       120
     KMVCIADDTK LVERLGSFPL PIEVIPFGWK ATRRSISALF RDLGYTDIDI VQRQRDGQPV       180
     VTDSGNFILD AHMVAITDKA LLDTNLNWIA GVVENGLFTG IAHEILIASP DGAAKLIELP       240
     HRRAARIPQW RK                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page