(data stored in ACNUC7421 zone)

EMBL: AP011115.RPLT

AP011115.RPLT        Location/Qualifiers
FT   CDS             complement(723351..723740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplT"
FT                   /locus_tag="ROP_06920"
FT                   /product="50S ribosomal protein L20"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06920"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48939"
FT                   /db_xref="GOA:C1AT07"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1AT07"
FT                   /protein_id="BAH48939.1"
FT                   /translation="MARVKRAVNAQKKRRSILEASSGYRGQRSRLYRKAKEQQLHSLTY
FT                   AYRDRRARKGDFRKLWITRINAAARANDITYNRLIQGLRLAEIEVDRKNLAELAVSDAA
FT                   AFAGLVALAKAALPADVNAPAGEAA"
     MARVKRAVNA QKKRRSILEA SSGYRGQRSR LYRKAKEQQL HSLTYAYRDR RARKGDFRKL        60
     WITRINAAAR ANDITYNRLI QGLRLAEIEV DRKNLAELAV SDAAAFAGLV ALAKAALPAD       120
     VNAPAGEAA                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page