(data stored in ACNUC7421 zone)

EMBL: AP011115.RPSA

AP011115.RPSA        Location/Qualifiers
FT   CDS             complement(741065..742549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsA"
FT                   /locus_tag="ROP_07090"
FT                   /product="30S ribosomal protein S1"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07090"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48956"
FT                   /db_xref="GOA:C1AT24"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT24"
FT                   /protein_id="BAH48956.1"
FT                   /translation="MPSTTVTSPQVAVNDIGSAEDFLAAIDATIKYFNDGDIVEGTIVK
FT                   VDRDEVLLDIGYKTEGVIPSRELSIKHDVDPNEVVSVGDEVEALVLTKEDKEGRLILSK
FT                   KRAQYERAWGTIEELKEKDEAVKGTVIEVVKGGLILDIGLRGFLPASLVEMRRVRDLQP
FT                   YVGKEIEAKIIELDKNRNNVVLSRRAWLEQTQSEVRSEFLHQLQKGQVRKGVVSSIVNF
FT                   GAFVDLGGVDGLVHVSELSWKHIDHPSEVVEVGTEVTVEVLDVDLDRERVSLSLKATQE
FT                   DPWRQFARTHAIGQIVPGKVTKLVPFGAFVRVEEGIEGLVHISELAERHVEVPDQVVGV
FT                   NDDALVKVIDIDLERRRISLSLKQANEDYNAEFDPSKYGMADSYDEQGNYIFPEGFDPE
FT                   TNEWLEGFDKQREEWENRYAEAERRHKMHTAQMEKTAADEAAEAATAAAGYSSESGAGD
FT                   ADAASSSSSSSSESAGGSLASDAQLAALREKLSGNA"
     MPSTTVTSPQ VAVNDIGSAE DFLAAIDATI KYFNDGDIVE GTIVKVDRDE VLLDIGYKTE        60
     GVIPSRELSI KHDVDPNEVV SVGDEVEALV LTKEDKEGRL ILSKKRAQYE RAWGTIEELK       120
     EKDEAVKGTV IEVVKGGLIL DIGLRGFLPA SLVEMRRVRD LQPYVGKEIE AKIIELDKNR       180
     NNVVLSRRAW LEQTQSEVRS EFLHQLQKGQ VRKGVVSSIV NFGAFVDLGG VDGLVHVSEL       240
     SWKHIDHPSE VVEVGTEVTV EVLDVDLDRE RVSLSLKATQ EDPWRQFART HAIGQIVPGK       300
     VTKLVPFGAF VRVEEGIEGL VHISELAERH VEVPDQVVGV NDDALVKVID IDLERRRISL       360
     SLKQANEDYN AEFDPSKYGM ADSYDEQGNY IFPEGFDPET NEWLEGFDKQ REEWENRYAE       420
     AERRHKMHTA QMEKTAADEA AEAATAAAGY SSESGAGDAD AASSSSSSSS ESAGGSLASD       480
     AQLAALREKL SGNA                                                         494
//

If you have problems or comments...

PBIL Back to PBIL home page