(data stored in ACNUC7421 zone)

EMBL: AP011115.SCPA

AP011115.SCPA        Location/Qualifiers
FT   CDS             complement(683601..684461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="scpA"
FT                   /locus_tag="ROP_06610"
FT                   /product="chromosome segregation and condensation protein
FT                   ScpA"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06610"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48908"
FT                   /db_xref="GOA:C1ASX6"
FT                   /db_xref="InterPro:IPR003768"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASX6"
FT                   /protein_id="BAH48908.1"
FT                   /translation="MVDTQDIPAPPQTEGSHGEDPQAPAGKPGFRVTLRNFEGPFDLLL
FT                   TLINQRQLDVTEVALHQVTDDFIAYMRTLGAEMGLDQTTEFLVVAATLLDLKAARLLPA
FT                   GQVEDAEDLALLEARDLLFARLLQYRAYKQVAQLFGELEAAALRRYPRSAALEDQFTRL
FT                   LPEVLLGVDPQRFAEIAATVFTPRPKPTVGLDHLHDMHAVSVPEQAARMLELLRERGAG
FT                   EWASFGDLVSECEITVEIVARFLALLELYREQSVLFEQPEPLGELLVSWTGEDTHAPVT
FT                   EEDYG"
     MVDTQDIPAP PQTEGSHGED PQAPAGKPGF RVTLRNFEGP FDLLLTLINQ RQLDVTEVAL        60
     HQVTDDFIAY MRTLGAEMGL DQTTEFLVVA ATLLDLKAAR LLPAGQVEDA EDLALLEARD       120
     LLFARLLQYR AYKQVAQLFG ELEAAALRRY PRSAALEDQF TRLLPEVLLG VDPQRFAEIA       180
     ATVFTPRPKP TVGLDHLHDM HAVSVPEQAA RMLELLRERG AGEWASFGDL VSECEITVEI       240
     VARFLALLEL YREQSVLFEQ PEPLGELLVS WTGEDTHAPV TEEDYG                      286
//

If you have problems or comments...

PBIL Back to PBIL home page