(data stored in ACNUC7421 zone)

EMBL: AP011115.SCPB

AP011115.SCPB        Location/Qualifiers
FT   CDS             complement(682912..683604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="scpB"
FT                   /locus_tag="ROP_06600"
FT                   /product="chromosome segregation and condensation protein
FT                   ScpB"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06600"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48907"
FT                   /db_xref="GOA:C1ASX5"
FT                   /db_xref="InterPro:IPR005234"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASX5"
FT                   /protein_id="BAH48907.1"
FT                   /translation="MSSAPFDEPDDQGAVDTEPELSDTELAAVLESLLLIVDSPAGAEQ
FT                   LASATGASVNRITETLNRMSAELTARGSGMDLRYAGDGWRLYTRTAYAPYVERLLLDGA
FT                   RSKLTRAALETLAVVAYRQPLTRARISAVRGVNVDGVVRTLLARGLIAEAGVDPDTNAT
FT                   QYSTTELFLERLGLASLADLPALAPLLPDVDLIDDISDSLESDPRFARMNKATASTEEL
FT                   DTGLDTED"
     MSSAPFDEPD DQGAVDTEPE LSDTELAAVL ESLLLIVDSP AGAEQLASAT GASVNRITET        60
     LNRMSAELTA RGSGMDLRYA GDGWRLYTRT AYAPYVERLL LDGARSKLTR AALETLAVVA       120
     YRQPLTRARI SAVRGVNVDG VVRTLLARGL IAEAGVDPDT NATQYSTTEL FLERLGLASL       180
     ADLPALAPLL PDVDLIDDIS DSLESDPRFA RMNKATASTE ELDTGLDTED                  230
//

If you have problems or comments...

PBIL Back to PBIL home page