(data stored in ACNUC7421 zone)

EMBL: AP011115.TATA

AP011115.TATA        Location/Qualifiers
FT   CDS             complement(594214..594495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatA"
FT                   /locus_tag="ROP_05750"
FT                   /product="Sec-independent protein translocase protein TatA"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05750"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48822"
FT                   /db_xref="GOA:C1ARZ5"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1ARZ5"
FT                   /protein_id="BAH48822.1"
FT                   /translation="MGAMSPWHWAIVALVVVILFGSKKLPDAARGLGRSLRIFKSEVKE
FT                   MQNDNSTPAPTAQQSAPAELPVADTTTAPVTPPAPVQPQPQHTEPKSA"
     MGAMSPWHWA IVALVVVILF GSKKLPDAAR GLGRSLRIFK SEVKEMQNDN STPAPTAQQS        60
     APAELPVADT TTAPVTPPAP VQPQPQHTEP KSA                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page