(data stored in ACNUC7421 zone)

EMBL: AP011115.TATC

AP011115.TATC        Location/Qualifiers
FT   CDS             complement(593102..594142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatC"
FT                   /locus_tag="ROP_05740"
FT                   /product="Sec-independent protein translocase protein TatC"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05740"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48821"
FT                   /db_xref="GOA:C1ARZ4"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARZ4"
FT                   /protein_id="BAH48821.1"
FT                   /translation="MRIPFDPRHSKRRTNPDGTMSLVDHLYELRTRLLLSVLAIVVTTA
FT                   VGFFWYSHQIFGIESLGELLRGPYCSLPESSRADLSNDGSCRLLATGPFEQFMLRFKVA
FT                   LTAGVVLACPIWLYQLWAFITPGLYAKERRYAIGFVVSGAALFIAGAVLAYVVVAKALH
FT                   FLLTIGDNVQITALGGAEYFGFIINLLIIFGVSFEIPLLIVALNFVGILPYAKLKAWRR
FT                   GLIFALFVFAAIATPGQDPFSMLALAFALTLLFEIAVQIARINDRRKARRTEQEWGALD
FT                   DDEASTIAAPADLNESFDVAAATVPESAGRFRRSRKSGKSGAANKNDAASTTGSNTPGQ
FT                   DFSDTL"
     MRIPFDPRHS KRRTNPDGTM SLVDHLYELR TRLLLSVLAI VVTTAVGFFW YSHQIFGIES        60
     LGELLRGPYC SLPESSRADL SNDGSCRLLA TGPFEQFMLR FKVALTAGVV LACPIWLYQL       120
     WAFITPGLYA KERRYAIGFV VSGAALFIAG AVLAYVVVAK ALHFLLTIGD NVQITALGGA       180
     EYFGFIINLL IIFGVSFEIP LLIVALNFVG ILPYAKLKAW RRGLIFALFV FAAIATPGQD       240
     PFSMLALAFA LTLLFEIAVQ IARINDRRKA RRTEQEWGAL DDDEASTIAA PADLNESFDV       300
     AAATVPESAG RFRRSRKSGK SGAANKNDAA STTGSNTPGQ DFSDTL                      346
//

If you have problems or comments...

PBIL Back to PBIL home page