(data stored in ACNUC7421 zone)

EMBL: AP011115.TESB

AP011115.TESB        Location/Qualifiers
FT   CDS             complement(765798..766676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tesB"
FT                   /locus_tag="ROP_07320"
FT                   /product="acyl-CoA thioesterase"
FT                   /EC_number="3.1.2.-"
FT                   /note="protein synonym:thioesterase II"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07320"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48979"
FT                   /db_xref="GOA:C1AT47"
FT                   /db_xref="InterPro:IPR003703"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042171"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT47"
FT                   /protein_id="BAH48979.1"
FT                   /translation="MSEVAAKTDLQTLLELLDLEKTGEDTYRGRHPAQVGSRTFGGQLI
FT                   SQALVAAGRTVSGERAVHAVNAHFIRGGDVKEPIEYRVERHRDGRAFANRQVTALQNGQ
FT                   ELFVMLAAFQDWGKGLEHAVEVPDVPFPDTLPPLGDHFQGYEDRLKMFVDALKPIDMRY
FT                   ANDPSWIMKGTGEKLTHNRVWMKSDGDLPDDPLIHVAVMGYSSDTTVLDSIITTHGLSW
FT                   GLDRIVAATVNHSIWFHRPFRFDDWTLYATESPVAAGSRGLATGRFFSLEGELLATVVQ
FT                   EGLIRHFPPRQ"
     MSEVAAKTDL QTLLELLDLE KTGEDTYRGR HPAQVGSRTF GGQLISQALV AAGRTVSGER        60
     AVHAVNAHFI RGGDVKEPIE YRVERHRDGR AFANRQVTAL QNGQELFVML AAFQDWGKGL       120
     EHAVEVPDVP FPDTLPPLGD HFQGYEDRLK MFVDALKPID MRYANDPSWI MKGTGEKLTH       180
     NRVWMKSDGD LPDDPLIHVA VMGYSSDTTV LDSIITTHGL SWGLDRIVAA TVNHSIWFHR       240
     PFRFDDWTLY ATESPVAAGS RGLATGRFFS LEGELLATVV QEGLIRHFPP RQ               292
//

If you have problems or comments...

PBIL Back to PBIL home page