(data stored in ACNUC7421 zone)

EMBL: AP011115.UVRA

AP011115.UVRA        Location/Qualifiers
FT   CDS             complement(727536..730529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrA"
FT                   /locus_tag="ROP_06990"
FT                   /product="UvrABC system protein A"
FT                   /note="protein synonym:excinuclease ABC subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06990"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48946"
FT                   /db_xref="GOA:C1AT14"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT14"
FT                   /protein_id="BAH48946.1"
FT                   /translation="MADRLIVRGAREHNLRGVDLDLPRDSLIVFTGLSGSGKSSLAFDT
FT                   IFAEGQRRYVESLSAYARQFLGQMDKPDVDFIEGLSPAVSIDQKSTNRNPRSTVGTITE
FT                   VYDYLRLLYARAGTAHCPVCGEQIARQTPQQIVDQVLEMEEGTRFQVLAPVVRTRKGEF
FT                   VDLFDQLNMQGYSRVRVDGVVYPLSEPPKLKKQEKHDIEVVVDRLTVKAGSKQRLTDSV
FT                   ETALRLAEGIVVLDFVDREENAADRERRFSEKLACPNGHALSIDDLEPRSFSFNSPYGA
FT                   CPECTGLGIRKEVDPDLVVPDPELSLGDGAIAPWSMGQSSEYFGRLLSGLGDILGFDMK
FT                   TPWNKLPAKARRAILEGSEEQVHVRYKNRYGRTRSYYAEFEGVMPFLHRRLEQTESDQM
FT                   KERYDGYMRDTPCPACGGARLRPEILSVTIANEKFGMKSIAEVCELSISDCADFLNSLT
FT                   LGSREEAIAGQVLKEVQARLGFLLDVGLEYLSLARAAGTLSGGEAQRIRLATQIGSGLV
FT                   GVLYVLDEPSIGLHQRDNRRLIETLTRLRDLGNTLIVVEHDEDTIRTSDWVVDIGPLAG
FT                   EHGGKVVHSGPYQELLDCEESLTGAYLSGRSHIEIPAIRRPVDRKRQVTVVGAREHNLG
FT                   GIDVSFPLGVLTSVTGVSGSGKSTLVNDILATVMANKLNGARQVPGRHTRINGLDQLDK
FT                   LVQVDQSPIGRTPRSNAATYTGVFDKIRTLFAATTESKVRGYQPGRFSFNVKGGRCEAC
FT                   SGDGTLKIEMNFLPDVYVPCEVCHGARYNRETLEVHYKGKTIAEVLDMPIEEAAEFFEP
FT                   ITSIHRYLKTLVEVGLGYVRLGQPAPTLSGGEAQRVKLAAELQKRSTGRTVYILDEPTT
FT                   GLHFEDIRKLLGVVNGLVDKGNTVIVIEHNLDVIKTSDWVVDMGPEGGSGGGTVVAQGT
FT                   PEDVAQVPESYTGRFLENVLAVPAPVAAKPKAAKSSPTRKSASAKKTAAATAATPRKRA
FT                   PKKAAAVS"
     MADRLIVRGA REHNLRGVDL DLPRDSLIVF TGLSGSGKSS LAFDTIFAEG QRRYVESLSA        60
     YARQFLGQMD KPDVDFIEGL SPAVSIDQKS TNRNPRSTVG TITEVYDYLR LLYARAGTAH       120
     CPVCGEQIAR QTPQQIVDQV LEMEEGTRFQ VLAPVVRTRK GEFVDLFDQL NMQGYSRVRV       180
     DGVVYPLSEP PKLKKQEKHD IEVVVDRLTV KAGSKQRLTD SVETALRLAE GIVVLDFVDR       240
     EENAADRERR FSEKLACPNG HALSIDDLEP RSFSFNSPYG ACPECTGLGI RKEVDPDLVV       300
     PDPELSLGDG AIAPWSMGQS SEYFGRLLSG LGDILGFDMK TPWNKLPAKA RRAILEGSEE       360
     QVHVRYKNRY GRTRSYYAEF EGVMPFLHRR LEQTESDQMK ERYDGYMRDT PCPACGGARL       420
     RPEILSVTIA NEKFGMKSIA EVCELSISDC ADFLNSLTLG SREEAIAGQV LKEVQARLGF       480
     LLDVGLEYLS LARAAGTLSG GEAQRIRLAT QIGSGLVGVL YVLDEPSIGL HQRDNRRLIE       540
     TLTRLRDLGN TLIVVEHDED TIRTSDWVVD IGPLAGEHGG KVVHSGPYQE LLDCEESLTG       600
     AYLSGRSHIE IPAIRRPVDR KRQVTVVGAR EHNLGGIDVS FPLGVLTSVT GVSGSGKSTL       660
     VNDILATVMA NKLNGARQVP GRHTRINGLD QLDKLVQVDQ SPIGRTPRSN AATYTGVFDK       720
     IRTLFAATTE SKVRGYQPGR FSFNVKGGRC EACSGDGTLK IEMNFLPDVY VPCEVCHGAR       780
     YNRETLEVHY KGKTIAEVLD MPIEEAAEFF EPITSIHRYL KTLVEVGLGY VRLGQPAPTL       840
     SGGEAQRVKL AAELQKRSTG RTVYILDEPT TGLHFEDIRK LLGVVNGLVD KGNTVIVIEH       900
     NLDVIKTSDW VVDMGPEGGS GGGTVVAQGT PEDVAQVPES YTGRFLENVL AVPAPVAAKP       960
     KAAKSSPTRK SASAKKTAAA TAATPRKRAP KKAAAVS                                997
//

If you have problems or comments...

PBIL Back to PBIL home page