(data stored in ACNUC7421 zone)

EMBL: AP011115.UVRB

AP011115.UVRB        Location/Qualifiers
FT   CDS             complement(736550..738712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrB"
FT                   /locus_tag="ROP_07050"
FT                   /product="UvrABC system protein B"
FT                   /note="protein synonym:excinuclease ABC subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07050"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48952"
FT                   /db_xref="GOA:C1AT20"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT20"
FT                   /protein_id="BAH48952.1"
FT                   /translation="MAFASEHPVVAHSEFRPIGEIERSEARFEVVSDHKPAGDQPTAIA
FT                   DLERRINAGEKDVVLLGATGTGKSATTAWLIEKVQRPTLVMAPNKTLAAQLANELRDML
FT                   PNNSVEYFVSYYDYYQPEAYIAQTDTYIEKDSSINDDVERLRHSATSSLLSRRDVVVVA
FT                   SVSCIYGLGTPQSYLDRSVQLEVGVEVPRDALLRLLVDVQYTRNDLAFTRGSFRVRGDT
FT                   VEIIPSYEELAVRIEFFGDEIEALYYLHPLTGDVVRKVDSVRIFPATHYVAGPERMERA
FT                   VKDIEAELEERLADLENKGKLLEAQRLRMRTQYDLEMIKQVGFCSGIENYSRHIDGRGP
FT                   GTAPATLIDYFPEDFLLVIDESHVTVPQIGAMYEGDMSRKRNLVEFGFRLPSATDNRPL
FT                   TWEEFTQRIGQTVYLSATPGKYELGQAGGEFVEQVIRPTGLVDPEVVVKPTKGQIDDLV
FT                   HEIRERADRDERVLVTTLTKKMAEDLTDYLLELGIRVRYLHSDIDTLRRVELLRQLRLG
FT                   EYDVLVGINLLREGLDLPEVSLVAILDADKEGFLRSSTSLIQTIGRAARNVSGQVHMYA
FT                   DKITDSMQHAIEETERRREKQIAYNEKMGVDPQPLRKKIADILDQVYEEAEDTASGVDV
FT                   GGSGRNATRGRRAQGEAGRSVSAGVYEGRDTKSMPRAELADLVKELTDQMMNAARDLQF
FT                   ELAGRLRDEIADLKKELRGMDAAGLK"
     MAFASEHPVV AHSEFRPIGE IERSEARFEV VSDHKPAGDQ PTAIADLERR INAGEKDVVL        60
     LGATGTGKSA TTAWLIEKVQ RPTLVMAPNK TLAAQLANEL RDMLPNNSVE YFVSYYDYYQ       120
     PEAYIAQTDT YIEKDSSIND DVERLRHSAT SSLLSRRDVV VVASVSCIYG LGTPQSYLDR       180
     SVQLEVGVEV PRDALLRLLV DVQYTRNDLA FTRGSFRVRG DTVEIIPSYE ELAVRIEFFG       240
     DEIEALYYLH PLTGDVVRKV DSVRIFPATH YVAGPERMER AVKDIEAELE ERLADLENKG       300
     KLLEAQRLRM RTQYDLEMIK QVGFCSGIEN YSRHIDGRGP GTAPATLIDY FPEDFLLVID       360
     ESHVTVPQIG AMYEGDMSRK RNLVEFGFRL PSATDNRPLT WEEFTQRIGQ TVYLSATPGK       420
     YELGQAGGEF VEQVIRPTGL VDPEVVVKPT KGQIDDLVHE IRERADRDER VLVTTLTKKM       480
     AEDLTDYLLE LGIRVRYLHS DIDTLRRVEL LRQLRLGEYD VLVGINLLRE GLDLPEVSLV       540
     AILDADKEGF LRSSTSLIQT IGRAARNVSG QVHMYADKIT DSMQHAIEET ERRREKQIAY       600
     NEKMGVDPQP LRKKIADILD QVYEEAEDTA SGVDVGGSGR NATRGRRAQG EAGRSVSAGV       660
     YEGRDTKSMP RAELADLVKE LTDQMMNAAR DLQFELAGRL RDEIADLKKE LRGMDAAGLK       720
//

If you have problems or comments...

PBIL Back to PBIL home page