(data stored in ACNUC30630 zone)

EMBL: AP011120.PE1

AP011120.PE1         Location/Qualifiers
FT   CDS             630..1244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pKNR02-00010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pKNR02-00010"
FT                   /db_xref="EnsemblGenomes-Tr:BAD95584"
FT                   /db_xref="UniProtKB/TrEMBL:Q564M8"
FT                   /protein_id="BAD95584.1"
FT                   /translation="MREGAREQSAPPKRQNVDLEQGSRVVSCRRGVRRCVLCGRSVGRV
FT                   ATPRSGITRAPGPGCSVACRGSRIVAPPYRSARCRCPGLPSPPPRPIGYALWSHYTRGP
FT                   AGGGLEGSSCITPPERHTPNAFALPEFSSTLVTAVSIVLKKPPDANPIGGFFYARTTFP
FT                   VPRQNTGNATRSISHDCEESRLVYLPNTRGMKKAGTYFGPA"
     MREGAREQSA PPKRQNVDLE QGSRVVSCRR GVRRCVLCGR SVGRVATPRS GITRAPGPGC        60
     SVACRGSRIV APPYRSARCR CPGLPSPPPR PIGYALWSHY TRGPAGGGLE GSSCITPPER       120
     HTPNAFALPE FSSTLVTAVS IVLKKPPDAN PIGGFFYART TFPVPRQNTG NATRSISHDC       180
     EESRLVYLPN TRGMKKAGTY FGPA                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page