(data stored in ACNUC30630 zone)

EMBL: AP011120.PE2

AP011120.PE2         Location/Qualifiers
FT   CDS             1374..1964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pKNR02-00020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pKNR02-00020"
FT                   /db_xref="EnsemblGenomes-Tr:BAD95585"
FT                   /db_xref="UniProtKB/TrEMBL:Q564M7"
FT                   /protein_id="BAD95585.1"
FT                   /translation="MPASPPSNNPSSGTPASMPGRPRWSASEAARRCGVGRSTIQRALV
FT                   AGRIPDAVETEKGWSIPLDGLLAAGFTPDRPSPPDPTLTSPPNPARGHDRAPTNNDGEH
FT                   ARRIAELELALERERARAELEHARRVAAEQLAAERAERVADLRHTLRMIEAPLAEQLHG
FT                   APEESPVEPPVAPATSTEQAPTLFGLLGRLLNR"
     MPASPPSNNP SSGTPASMPG RPRWSASEAA RRCGVGRSTI QRALVAGRIP DAVETEKGWS        60
     IPLDGLLAAG FTPDRPSPPD PTLTSPPNPA RGHDRAPTNN DGEHARRIAE LELALERERA       120
     RAELEHARRV AAEQLAAERA ERVADLRHTL RMIEAPLAEQ LHGAPEESPV EPPVAPATST       180
     EQAPTLFGLL GRLLNR                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page