(data stored in ACNUC10043 zone)

EMBL: AP011532.AROK

AP011532.AROK        Location/Qualifiers
FT   CDS             complement(164877..165719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroK"
FT                   /locus_tag="MCP_0170"
FT                   /product="shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0170"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60242"
FT                   /db_xref="GOA:D1YUX0"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR010189"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUX0"
FT                   /protein_id="BAI60242.1"
FT                   /translation="MRGHGIAFGAGTVINAIATYKGSAFGITLKTEAEVTLRGDLVEGE
FT                   IEGGGDTRLIERACELVLEEFDVDSGAKIRTKSQVPQASGLKSSSAAANATVLATLRAI
FT                   GRDMEPLDMVRLGVRAALDTGVSITGAFDDACASMLGGIVVTDNRNNELLKREPVESDV
FT                   IIYAPDKKAFSSQTNVARSRAIGPWVDAAFDMAMRGEYRRAMTLNGFLYTAALGYSPEP
FT                   MMAALELGVDAVSLSGTGPSYVALASGEKLEELRAAWSSYPGKVMITRTNNTGAHTLR"
     MRGHGIAFGA GTVINAIATY KGSAFGITLK TEAEVTLRGD LVEGEIEGGG DTRLIERACE        60
     LVLEEFDVDS GAKIRTKSQV PQASGLKSSS AAANATVLAT LRAIGRDMEP LDMVRLGVRA       120
     ALDTGVSITG AFDDACASML GGIVVTDNRN NELLKREPVE SDVIIYAPDK KAFSSQTNVA       180
     RSRAIGPWVD AAFDMAMRGE YRRAMTLNGF LYTAALGYSP EPMMAALELG VDAVSLSGTG       240
     PSYVALASGE KLEELRAAWS SYPGKVMITR TNNTGAHTLR                             280
//

If you have problems or comments...

PBIL Back to PBIL home page