(data stored in ACNUC10043 zone)

EMBL: AP011532.ATPB-1

AP011532.ATPB-1      Location/Qualifiers
FT   CDS             complement(343071..344456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpB-1"
FT                   /locus_tag="MCP_0338"
FT                   /product="A-type ATP synthase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0338"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60410"
FT                   /db_xref="GOA:D1YVD8"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022879"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVD8"
FT                   /protein_id="BAI60410.1"
FT                   /translation="MKEYKTITEIAGPLVFVKKTEPVSYNELVSIQLSDGSIKRGQVLD
FT                   TSKDVVVVQVFEGTEGISRECGVKFLGEAIKMPVSKDMLGRILSGAGDPLDGGPAIIPE
FT                   KRLDIVGAAINPYSRRQPKDFIQTGISTIDGMNTLVRGQKLPIFSGAGLPHNEIALQIA
FT                   RQAKVVGSTEPFAVVFCAMGITSEEAQTFMQDFERTGALERAVVFMNLADDPAIERIIT
FT                   PRLALTTAEYLAFEHDMHVLVIYTDMTNYCEALRQIGAAREEVPGRRGYPGYMYTDLAM
FT                   LYERAGMIDGKKGSITQVPILTMPGDDITHPIPDLTGYITEGQIVVARDLHRKGIYPPI
FT                   NVSPSLSRLMNLGIGVGKTREDHKAVSDQCYSAYAEGKDLRGLVAIVGKDALSERDRKF
FT                   LEFADIFEDKLVRQSREEDRTIEQTLDMMWGLLATLPVTELNKIDNKYIDKYHPAKKAK
FT                   VAA"
     MKEYKTITEI AGPLVFVKKT EPVSYNELVS IQLSDGSIKR GQVLDTSKDV VVVQVFEGTE        60
     GISRECGVKF LGEAIKMPVS KDMLGRILSG AGDPLDGGPA IIPEKRLDIV GAAINPYSRR       120
     QPKDFIQTGI STIDGMNTLV RGQKLPIFSG AGLPHNEIAL QIARQAKVVG STEPFAVVFC       180
     AMGITSEEAQ TFMQDFERTG ALERAVVFMN LADDPAIERI ITPRLALTTA EYLAFEHDMH       240
     VLVIYTDMTN YCEALRQIGA AREEVPGRRG YPGYMYTDLA MLYERAGMID GKKGSITQVP       300
     ILTMPGDDIT HPIPDLTGYI TEGQIVVARD LHRKGIYPPI NVSPSLSRLM NLGIGVGKTR       360
     EDHKAVSDQC YSAYAEGKDL RGLVAIVGKD ALSERDRKFL EFADIFEDKL VRQSREEDRT       420
     IEQTLDMMWG LLATLPVTEL NKIDNKYIDK YHPAKKAKVA A                           461
//

If you have problems or comments...

PBIL Back to PBIL home page