(data stored in ACNUC10043 zone)

EMBL: AP011532.ATPF-1

AP011532.ATPF-1      Location/Qualifiers
FT   CDS             complement(346228..346527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpF-1"
FT                   /locus_tag="MCP_0340"
FT                   /product="A-type ATP synthase subunit F"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0340"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60412"
FT                   /db_xref="GOA:D1YVE0"
FT                   /db_xref="InterPro:IPR008218"
FT                   /db_xref="InterPro:IPR022944"
FT                   /db_xref="InterPro:IPR036906"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVE0"
FT                   /protein_id="BAI60412.1"
FT                   /translation="MDIAVIGKSDFTTGFRLAGIRKVYDVASEKDLEEKVRQCINDGDV
FT                   GIVVLYADDVKKLPTVLQKTVDESVEPTFIAIGGREESGLRDKIKRAIGVDLWK"
     MDIAVIGKSD FTTGFRLAGI RKVYDVASEK DLEEKVRQCI NDGDVGIVVL YADDVKKLPT        60
     VLQKTVDESV EPTFIAIGGR EESGLRDKIK RAIGVDLWK                               99
//

If you have problems or comments...

PBIL Back to PBIL home page