(data stored in ACNUC10043 zone)

EMBL: AP011532.ATPH

AP011532.ATPH        Location/Qualifiers
FT   CDS             complement(350401..350745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpH"
FT                   /locus_tag="MCP_0345"
FT                   /product="A-type ATP synthase subunit H"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0345"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60417"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVE5"
FT                   /protein_id="BAI60417.1"
FT                   /translation="MSRAEILSQLKQTEEEAKVRKAKAEEEAKQIAAAARKDASGIVEA
FT                   ARSKASADADAKVKKASAEIQAEANAQKSEGEKQAAALKTSAKAKVNAATDYLMKEFEG
FT                   YVNARTSTHG"
     MSRAEILSQL KQTEEEAKVR KAKAEEEAKQ IAAAARKDAS GIVEAARSKA SADADAKVKK        60
     ASAEIQAEAN AQKSEGEKQA AALKTSAKAK VNAATDYLMK EFEGYVNART STHG             114
//

If you have problems or comments...

PBIL Back to PBIL home page