(data stored in ACNUC10043 zone)

EMBL: AP011532.ATPK-1

AP011532.ATPK-1      Location/Qualifiers
FT   CDS             complement(348182..348397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpK-1"
FT                   /locus_tag="MCP_0343"
FT                   /product="A-type ATP synthase subunit K"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0343"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60415"
FT                   /db_xref="GOA:D1YVE3"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVE3"
FT                   /protein_id="BAI60415.1"
FT                   /translation="MPVEGLVAIGAGLAVGLAGIGSGIAEKDIGAAAVGAIAEDRSFFG
FT                   QGLIFTVIPETIVIFGLVIAILLMFL"
     MPVEGLVAIG AGLAVGLAGI GSGIAEKDIG AAAVGAIAED RSFFGQGLIF TVIPETIVIF        60
     GLVIAILLMF L                                                             71
//

If you have problems or comments...

PBIL Back to PBIL home page