(data stored in ACNUC10043 zone)

EMBL: AP011532.BIRA

AP011532.BIRA        Location/Qualifiers
FT   CDS             382916..383878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="birA"
FT                   /locus_tag="MCP_0378"
FT                   /product="biotin operon
FT                   repressor/biotin--[acetyl-CoA-carboxylase] synthetase"
FT                   /note="bifunctional protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0378"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60450"
FT                   /db_xref="GOA:D1YVH8"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR030855"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVH8"
FT                   /protein_id="BAI60450.1"
FT                   /translation="MTKEEILNILREAGDYVSGEFLAEKLGVSRAAVWKHIHTLIKEGY
FT                   AVDVAQGKGYRLMSVPDKLYPAEIRHGLQTKLLGRKVIHLNVTGSTNTVARQVAERGVE
FT                   EGTVVLAETQSHGKGRLGRKWVAKPGSLAMSVILKPAIDPMHASSITLMAAVSVTKALR
FT                   GAGLEAAIKWPNDVLVNGKKICGILTEMSAETDIVNFIILGIGVNVNNDVPLETATTMK
FT                   AELSREVDRVKFTQLLLEMLEEDYLTFKEEGFTPILWSWRRYSDTLGRLVEVTYQDEVV
FT                   TGVAQDVDEDGSLLVKTADGSIRKIVSGDCKHLRGARKL"
     MTKEEILNIL REAGDYVSGE FLAEKLGVSR AAVWKHIHTL IKEGYAVDVA QGKGYRLMSV        60
     PDKLYPAEIR HGLQTKLLGR KVIHLNVTGS TNTVARQVAE RGVEEGTVVL AETQSHGKGR       120
     LGRKWVAKPG SLAMSVILKP AIDPMHASSI TLMAAVSVTK ALRGAGLEAA IKWPNDVLVN       180
     GKKICGILTE MSAETDIVNF IILGIGVNVN NDVPLETATT MKAELSREVD RVKFTQLLLE       240
     MLEEDYLTFK EEGFTPILWS WRRYSDTLGR LVEVTYQDEV VTGVAQDVDE DGSLLVKTAD       300
     GSIRKIVSGD CKHLRGARKL                                                   320
//

If you have problems or comments...

PBIL Back to PBIL home page