(data stored in ACNUC10043 zone)

EMBL: AP011532.MOAA

AP011532.MOAA        Location/Qualifiers
FT   CDS             635406..636344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moaA"
FT                   /locus_tag="MCP_0653"
FT                   /product="probable molybdenum cofactor biosynthesis protein
FT                   A"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0653"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60725"
FT                   /db_xref="GOA:D1YWA3"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013485"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWA3"
FT                   /protein_id="BAI60725.1"
FT                   /translation="MQESLVDNYGRRVTSLRMSLTNRCNLQCIYCHNEGESGSGGEITV
FT                   DEIARLVRIATKYGVDRVKFSGGEPLLRTDLEDILRALPPLKDISLTTNGTLLAPRAKG
FT                   LKEAGLDRVNISLDTMDSGRFDLITQRKGQFSRVMDGINAAIDAGLTPVKLNMVYLKGI
FT                   NEDEIERMIEFIRGRPLVLQVIELMNFKGAFKYHADISALEHSLKARADDYKCREMHRR
FT                   TKYYLNGAEVEIVRPIDNSEFCMNCNRLRVTSDFKLKPCLLRNDNLVSLRGLDDEGLEK
FT                   ALRYTVGIREPFFKAAPVAMPKKSEKVPSEN"
     MQESLVDNYG RRVTSLRMSL TNRCNLQCIY CHNEGESGSG GEITVDEIAR LVRIATKYGV        60
     DRVKFSGGEP LLRTDLEDIL RALPPLKDIS LTTNGTLLAP RAKGLKEAGL DRVNISLDTM       120
     DSGRFDLITQ RKGQFSRVMD GINAAIDAGL TPVKLNMVYL KGINEDEIER MIEFIRGRPL       180
     VLQVIELMNF KGAFKYHADI SALEHSLKAR ADDYKCREMH RRTKYYLNGA EVEIVRPIDN       240
     SEFCMNCNRL RVTSDFKLKP CLLRNDNLVS LRGLDDEGLE KALRYTVGIR EPFFKAAPVA       300
     MPKKSEKVPS EN                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page