(data stored in ACNUC10043 zone)

EMBL: AP011532.MOAC

AP011532.MOAC        Location/Qualifiers
FT   CDS             701201..701677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moaC"
FT                   /locus_tag="MCP_0729"
FT                   /product="probable molybdenum cofactor biosynthesis protein
FT                   C"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0729"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60801"
FT                   /db_xref="GOA:D1YWH9"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR023047"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWH9"
FT                   /protein_id="BAI60801.1"
FT                   /translation="MRSTDFTHVEGDKVKMVDVGSKEEVVRIARASGTIHLTKETMALI
FT                   KAGNVKKGNVLAAARIAAIQAAKHTWETIPLCHQIPITGIDVEFEVGDTDIKAIAEVRS
FT                   VGKTGVEMEALCAVSTALLTIWDMVKAVEKDETGNYPETKITNIVVDKKIKAKQ"
     MRSTDFTHVE GDKVKMVDVG SKEEVVRIAR ASGTIHLTKE TMALIKAGNV KKGNVLAAAR        60
     IAAIQAAKHT WETIPLCHQI PITGIDVEFE VGDTDIKAIA EVRSVGKTGV EMEALCAVST       120
     ALLTIWDMVK AVEKDETGNY PETKITNIVV DKKIKAKQ                               158
//

If you have problems or comments...

PBIL Back to PBIL home page