(data stored in ACNUC10043 zone)

EMBL: AP011532.MSRB

AP011532.MSRB        Location/Qualifiers
FT   CDS             complement(594266..594709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msrB"
FT                   /locus_tag="MCP_0614"
FT                   /product="peptide methionine sulfoxide reductase MsrB"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0614"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60686"
FT                   /db_xref="GOA:D1YW64"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW64"
FT                   /protein_id="BAI60686.1"
FT                   /translation="MTQVSKPPKEELKKKLTPMQYKVTQEQGTEPPFQNEFWNEHREGL
FT                   YVDIVTGEPLFTSKDKFDSGCGWPSFTKPMEKGKVEEKIDTSHGMVRTEVRGKGSDSHL
FT                   GHVFNDGPGPSGLRYCINSAALRFIPKEDLEKEGYGEYRKLFE"
     MTQVSKPPKE ELKKKLTPMQ YKVTQEQGTE PPFQNEFWNE HREGLYVDIV TGEPLFTSKD        60
     KFDSGCGWPS FTKPMEKGKV EEKIDTSHGM VRTEVRGKGS DSHLGHVFND GPGPSGLRYC       120
     INSAALRFIP KEDLEKEGYG EYRKLFE                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page