(data stored in ACNUC10043 zone)

EMBL: AP011532.MTRH

AP011532.MTRH        Location/Qualifiers
FT   CDS             529405..530355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtrH"
FT                   /locus_tag="MCP_0546"
FT                   /product="tetrahydromethanopterin S-methyltransferase
FT                   subunit H"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0546"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60618"
FT                   /db_xref="GOA:D1YVZ6"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR023467"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVZ6"
FT                   /protein_id="BAI60618.1"
FT                   /translation="MFKYDTPQKVYEVGRAKVGGNPGEYPTVLAGSIFYNKEPIFASKE
FT                   DSAKGIFNKEGAEKLIRQQEEMSDITGNKVWVQIVSETEESMIKYIEWYSNVGKDAFLV
FT                   DSTVASARIAGAKKADEIGISDRVIYNSINAAAQQAEMDAIKPLKFTSAIILGFNAVDM
FT                   SVKGRMEMFTKGGAGQAKGMLTLGTEKGITRPLLDVAATPLGSGSGATYRSIFAVKSQL
FT                   GEPVGGGYHNIPSAWAWLKKFKKQPGKEGAYMPSDIGSNLVAITLGCNFCLYGPIEHSV
FT                   EVFPAVAMNDIIVAEAAKDLGTAPLSEVNPLTKLA"
     MFKYDTPQKV YEVGRAKVGG NPGEYPTVLA GSIFYNKEPI FASKEDSAKG IFNKEGAEKL        60
     IRQQEEMSDI TGNKVWVQIV SETEESMIKY IEWYSNVGKD AFLVDSTVAS ARIAGAKKAD       120
     EIGISDRVIY NSINAAAQQA EMDAIKPLKF TSAIILGFNA VDMSVKGRME MFTKGGAGQA       180
     KGMLTLGTEK GITRPLLDVA ATPLGSGSGA TYRSIFAVKS QLGEPVGGGY HNIPSAWAWL       240
     KKFKKQPGKE GAYMPSDIGS NLVAITLGCN FCLYGPIEHS VEVFPAVAMN DIIVAEAAKD       300
     LGTAPLSEVN PLTKLA                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page