(data stored in ACNUC10043 zone)

EMBL: AP011532.PE100

AP011532.PE100       Location/Qualifiers
FT   CDS             88982..90082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0100"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0100"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60172"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUQ0"
FT                   /protein_id="BAI60172.1"
FT                   /translation="MSNNLLNVIKEVFSTYNYTVSASQQGFDLLAEKPGYRVGIKLVDD
FT                   ASADDLKTFLDGLNGSGIKVLFITMAGFSEDVKKLGGQRELMMWDRAELARQIGNAVLS
FT                   GCEAPAQAKPAADISSLTSELYASRPAVQPKPEPAQPRAVKAPEPVIEAVEEEKPAKKK
FT                   AKPEPAVEAATEPAEGVSIPLHAIPIKVKDSDAIKISGAIGRAEDVELSIKFIPFWKYD
FT                   YKLDVQSRYRDLTVPLNSKGSRVINAINKQVDPAPQAAPVESVDLPDAPYDVQETVVSE
FT                   EEARAMAIKAIVEENTKTVRFKGTQGEAAIVEHKKFQPRPQDVEMDIELVYIPFWAVRS
FT                   HKGYMEINAYDGKPTRMPIDDGAEIL"
     MSNNLLNVIK EVFSTYNYTV SASQQGFDLL AEKPGYRVGI KLVDDASADD LKTFLDGLNG        60
     SGIKVLFITM AGFSEDVKKL GGQRELMMWD RAELARQIGN AVLSGCEAPA QAKPAADISS       120
     LTSELYASRP AVQPKPEPAQ PRAVKAPEPV IEAVEEEKPA KKKAKPEPAV EAATEPAEGV       180
     SIPLHAIPIK VKDSDAIKIS GAIGRAEDVE LSIKFIPFWK YDYKLDVQSR YRDLTVPLNS       240
     KGSRVINAIN KQVDPAPQAA PVESVDLPDA PYDVQETVVS EEEARAMAIK AIVEENTKTV       300
     RFKGTQGEAA IVEHKKFQPR PQDVEMDIEL VYIPFWAVRS HKGYMEINAY DGKPTRMPID       360
     DGAEIL                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page