(data stored in ACNUC10043 zone)

EMBL: AP011532.PE111

AP011532.PE111       Location/Qualifiers
FT   CDS             100790..101104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0111"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Protein of unknown function DUF167
FT                   family (IPR003746).; Belongs to the Conserved hypothetical
FT                   protein 251 family (IPR005228)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0111"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60183"
FT                   /db_xref="InterPro:IPR003746"
FT                   /db_xref="InterPro:IPR005228"
FT                   /db_xref="InterPro:IPR036591"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUR1"
FT                   /protein_id="BAI60183.1"
FT                   /translation="MAFQDAVRASSDGVLIDFEVSPGAKETRVPSGYNEWRRRIEARLK
FT                   APPERGRANEELIGELSALLGIPESRIEITSGARDSRKSVKVLGASREEVLRRLGGALQ
FT                   "
     MAFQDAVRAS SDGVLIDFEV SPGAKETRVP SGYNEWRRRI EARLKAPPER GRANEELIGE        60
     LSALLGIPES RIEITSGARD SRKSVKVLGA SREEVLRRLG GALQ                        104
//

If you have problems or comments...

PBIL Back to PBIL home page