(data stored in ACNUC10043 zone)

EMBL: AP011532.PE112

AP011532.PE112       Location/Qualifiers
FT   CDS             101149..101514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0112"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one TOPRIM domain (IPR006171)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0112"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60184"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR022972"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUR2"
FT                   /protein_id="BAI60184.1"
FT                   /translation="MAARAEMGTTILVEGPRDRASMESLGITGNIVMTSQETLFNLAER
FT                   VSRQSADIIVLTDWDERGEEVARNAETYLKSNGSRPDMEPRKKLRILTKKEVKDIEGLH
FT                   GYIERLRLACAVKPQHY"
     MAARAEMGTT ILVEGPRDRA SMESLGITGN IVMTSQETLF NLAERVSRQS ADIIVLTDWD        60
     ERGEEVARNA ETYLKSNGSR PDMEPRKKLR ILTKKEVKDI EGLHGYIERL RLACAVKPQH       120
     Y                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page