(data stored in ACNUC10043 zone)

EMBL: AP011532.PE117

AP011532.PE117       Location/Qualifiers
FT   CDS             112096..112569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0117"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0117"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60189"
FT                   /db_xref="GOA:D1YUR7"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUR7"
FT                   /protein_id="BAI60189.1"
FT                   /translation="MDLDDITKELDKAGKPGRLPERKPDFRVKQGMLKAYFLKLLAFVL
FT                   LIVVAGFGFLVVFNYRSLVMMLIVLVYLGLGIFLAFKLFVLTYTGWLYTLLLSAAGVFM
FT                   PVLALISRGFSNPTFTAGAFGIIALSLLSVLLLWWAKDLFGIKSYREIFVPYK"
     MDLDDITKEL DKAGKPGRLP ERKPDFRVKQ GMLKAYFLKL LAFVLLIVVA GFGFLVVFNY        60
     RSLVMMLIVL VYLGLGIFLA FKLFVLTYTG WLYTLLLSAA GVFMPVLALI SRGFSNPTFT       120
     AGAFGIIALS LLSVLLLWWA KDLFGIKSYR EIFVPYK                                157
//

If you have problems or comments...

PBIL Back to PBIL home page