(data stored in ACNUC10043 zone)

EMBL: AP011532.PE121

AP011532.PE121       Location/Qualifiers
FT   CDS             117292..118470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0121"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Radical SAM domain (IPR007197)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0121"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60193"
FT                   /db_xref="GOA:D1YUS1"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR040088"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUS1"
FT                   /protein_id="BAI60193.1"
FT                   /translation="MLSMAVFSEVYDEDNDKVFVIRGTIEVRIPHNFYSQLKRKYSDEE
FT                   IVSMQEPKILRHHHTKRELVYVTKESGLPLIGHTAFGLIDRGTNLIQVRPVSGCNLNCI
FT                   FCSVDEGVSKSRRTDYIVDTDYLVEEFAKLAALKGDDVEAHIDGQGEPFIYPYMVELLE
FT                   KLRKVPHVKVISAQTNGMLLDPEKIRAMEGLLDRINLSISSMDPRRGRMLAGTNLYDVE
FT                   HVKEVARAVAASDIDLLLAPVWVPGFNDEDIPKLIEFGLEIGAGKRWPGFGIQNYVRYQ
FT                   FGKKVRGRPMKFSEFFKRLEEYGKQYGLNLKLTPADFGIHKAPGLPRAFRRGERVKLEL
FT                   VAPGRVFGEMLAVSRGRVIGVLTDRPAGSTVFAEITRTNDNVYVAVTAESRL"
     MLSMAVFSEV YDEDNDKVFV IRGTIEVRIP HNFYSQLKRK YSDEEIVSMQ EPKILRHHHT        60
     KRELVYVTKE SGLPLIGHTA FGLIDRGTNL IQVRPVSGCN LNCIFCSVDE GVSKSRRTDY       120
     IVDTDYLVEE FAKLAALKGD DVEAHIDGQG EPFIYPYMVE LLEKLRKVPH VKVISAQTNG       180
     MLLDPEKIRA MEGLLDRINL SISSMDPRRG RMLAGTNLYD VEHVKEVARA VAASDIDLLL       240
     APVWVPGFND EDIPKLIEFG LEIGAGKRWP GFGIQNYVRY QFGKKVRGRP MKFSEFFKRL       300
     EEYGKQYGLN LKLTPADFGI HKAPGLPRAF RRGERVKLEL VAPGRVFGEM LAVSRGRVIG       360
     VLTDRPAGST VFAEITRTND NVYVAVTAES RL                                     392
//

If you have problems or comments...

PBIL Back to PBIL home page