(data stored in ACNUC10043 zone)

EMBL: AP011532.PE122

AP011532.PE122       Location/Qualifiers
FT   CDS             complement(118448..119443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0122"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Protein kinasedomain (IPR000719)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0122"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60194"
FT                   /db_xref="GOA:D1YUS2"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUS2"
FT                   /protein_id="BAI60194.1"
FT                   /translation="MGEYGRAPDVLERAGHAVLNNFFVEAALVFLISVLYISAQGADRL
FT                   LGTGFRRTLLDWMQAVSRDRLNFLRKAQIRHVFKKKYGMKKIKIRLAGGSYWLSIPCIV
FT                   KGVCKKTRSERKFLAKVMNERSALKHKYMTLFRNIGVIAEGVDLKFDDYHCGLEMGQYE
FT                   RLCLEKLRNASVNAPKVYGLHKMGGADYMLVMEYIDGKPLSKAEMSGEIMDQLFLILKK
FT                   MRENGILHGDVKLDNFMLSNGRVYVFDCLKIDRSGIEEAAAFDLACLLCALSGRLPPGE
FT                   VVKNARKFYSPSDLGRAAGMVDMALYKADLNLSDDRKKELKESLKALTLP"
     MGEYGRAPDV LERAGHAVLN NFFVEAALVF LISVLYISAQ GADRLLGTGF RRTLLDWMQA        60
     VSRDRLNFLR KAQIRHVFKK KYGMKKIKIR LAGGSYWLSI PCIVKGVCKK TRSERKFLAK       120
     VMNERSALKH KYMTLFRNIG VIAEGVDLKF DDYHCGLEMG QYERLCLEKL RNASVNAPKV       180
     YGLHKMGGAD YMLVMEYIDG KPLSKAEMSG EIMDQLFLIL KKMRENGILH GDVKLDNFML       240
     SNGRVYVFDC LKIDRSGIEE AAAFDLACLL CALSGRLPPG EVVKNARKFY SPSDLGRAAG       300
     MVDMALYKAD LNLSDDRKKE LKESLKALTL P                                      331
//

If you have problems or comments...

PBIL Back to PBIL home page