(data stored in ACNUC10043 zone)

EMBL: AP011532.PE126

AP011532.PE126       Location/Qualifiers
FT   CDS             120313..120513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0126"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0126"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60198"
FT                   /db_xref="GOA:D1YUS6"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUS6"
FT                   /protein_id="BAI60198.1"
FT                   /translation="MKAKDAKIAYIALAFLIALCAIVASYLRQYYIALGLIVMASAIML
FT                   GGAILVSYMYKMEKAEELKKI"
     MKAKDAKIAY IALAFLIALC AIVASYLRQY YIALGLIVMA SAIMLGGAIL VSYMYKMEKA        60
     EELKKI                                                                   66
//

If you have problems or comments...

PBIL Back to PBIL home page