(data stored in ACNUC10043 zone)

EMBL: AP011532.PE134

AP011532.PE134       Location/Qualifiers
FT   CDS             128676..129389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0134"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Protein of unknown function
FT                   DUF375family (IPR007183)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0134"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60206"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR007183"
FT                   /db_xref="InterPro:IPR037456"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUT4"
FT                   /protein_id="BAI60206.1"
FT                   /translation="MLTRKYQVKETIVTVTADEQYHPVCLASIGRSRSDLERHILEDPF
FT                   FKVTFEPYECPPGAPEVVKRMVDAASRVGVGPMAAVAGTIAWLALEDMVKAGCTYGIID
FT                   NGGDIALINDRTVVVGIYAGESPIKGFGLEIGPRDHILGVCTSSATVGPSISLGNSDAA
FT                   LIISEDVSLADAAATALGNRIVDKESLATAFDFLKSIPEVSGAIGIIGDRMATYGRLPE
FT                   IVRADVDQGKITKGD"
     MLTRKYQVKE TIVTVTADEQ YHPVCLASIG RSRSDLERHI LEDPFFKVTF EPYECPPGAP        60
     EVVKRMVDAA SRVGVGPMAA VAGTIAWLAL EDMVKAGCTY GIIDNGGDIA LINDRTVVVG       120
     IYAGESPIKG FGLEIGPRDH ILGVCTSSAT VGPSISLGNS DAALIISEDV SLADAAATAL       180
     GNRIVDKESL ATAFDFLKSI PEVSGAIGII GDRMATYGRL PEIVRADVDQ GKITKGD          237
//

If you have problems or comments...

PBIL Back to PBIL home page