(data stored in ACNUC10043 zone)

EMBL: AP011532.PE150

AP011532.PE150       Location/Qualifiers
FT   CDS             147471..147833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0150"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0150"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60222"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUV0"
FT                   /protein_id="BAI60222.1"
FT                   /translation="MARKVDVKLFGYYPEAGCSECSNYSSCGGQAHRQDDGTVKALLDA
FT                   YGDRVEVSLVNVFSDVMKGYPEVADCIRKNGLRVPIVTVDGKLKLFGSEATLDAIRREV
FT                   DLELNWGPLSFLSRRP"
     MARKVDVKLF GYYPEAGCSE CSNYSSCGGQ AHRQDDGTVK ALLDAYGDRV EVSLVNVFSD        60
     VMKGYPEVAD CIRKNGLRVP IVTVDGKLKL FGSEATLDAI RREVDLELNW GPLSFLSRRP       120
//

If you have problems or comments...

PBIL Back to PBIL home page