(data stored in ACNUC10043 zone)

EMBL: AP011532.PE155

AP011532.PE155       Location/Qualifiers
FT   CDS             152797..153180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0155"
FT                   /product="putative universal stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0155"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60227"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUV5"
FT                   /protein_id="BAI60227.1"
FT                   /translation="MKVLLATDGMPHTDRAIDYAIDYASRYRAALFVVYALSPGRDQKA
FT                   AYAEGKETVQGIKQKALSREVGITTMLEAGEPAEAIVRTADKIGADAVILGASGKCEGR
FT                   KRPLGSVSARVVQDACCSVFIIR"
     MKVLLATDGM PHTDRAIDYA IDYASRYRAA LFVVYALSPG RDQKAAYAEG KETVQGIKQK        60
     ALSREVGITT MLEAGEPAEA IVRTADKIGA DAVILGASGK CEGRKRPLGS VSARVVQDAC       120
     CSVFIIR                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page