(data stored in ACNUC10043 zone)

EMBL: AP011532.PE177

AP011532.PE177       Location/Qualifiers
FT   CDS             170491..171240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0177"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0177"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60249"
FT                   /db_xref="GOA:D1YUX7"
FT                   /db_xref="InterPro:IPR010624"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUX7"
FT                   /protein_id="BAI60249.1"
FT                   /translation="MTEIKNRARFGIQDLDNALDGGLPRGSLVLIEEDTGAKSQILQSK
FT                   FIADGLLNNEYCYIFNMEHPPQAIVNSLNVFGLEPEENINSDQLMIIDGFTDAFGWGEF
FT                   VSKWKYVCHDLASITEVHDVVKQATAEIKPYNNLRGVVDSLTTLILASDSERSILNYIH
FT                   HQMAIQKNYGTTTLYTIHMGAHRPELIKALEHIVDGVIWISKVEVDDEPRDVIQIKKLR
FT                   DSKYSSRKYFFNADEEGAALEVMKKHP"
     MTEIKNRARF GIQDLDNALD GGLPRGSLVL IEEDTGAKSQ ILQSKFIADG LLNNEYCYIF        60
     NMEHPPQAIV NSLNVFGLEP EENINSDQLM IIDGFTDAFG WGEFVSKWKY VCHDLASITE       120
     VHDVVKQATA EIKPYNNLRG VVDSLTTLIL ASDSERSILN YIHHQMAIQK NYGTTTLYTI       180
     HMGAHRPELI KALEHIVDGV IWISKVEVDD EPRDVIQIKK LRDSKYSSRK YFFNADEEGA       240
     ALEVMKKHP                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page