(data stored in ACNUC10043 zone)

EMBL: AP011532.PE178

AP011532.PE178       Location/Qualifiers
FT   CDS             171397..172518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0178"
FT                   /product="hypothetical protein"
FT                   /note="Contains at least one Tetratricopeptide region
FT                   domain (IPR013026).; Contains at least four
FT                   Tetratricopeptide TPR_1 repeats (IPR001440).; Contains at
FT                   least three Tetratricopeptide TPR_2 repeats (IPR013105)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0178"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60250"
FT                   /db_xref="GOA:D1YUX8"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR037919"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUX8"
FT                   /protein_id="BAI60250.1"
FT                   /translation="MRNAWHKKKWGIMKDIVRALGLITKGLLVDGRAEEPGAEKARAYL
FT                   GRRDYAHAAEELKKAISSHPDDPEAHYDLGVALVRAGKLDDAMGSFVAAIKLDPGFAEA
FT                   HYNLGVVFAKKGMLDDAIREYNRAARLRPDYAKAHFNLALALTNKGLHDHAKSELMAVG
FT                   GIRRRQALEHYNRGVELAGRDEAILSMAEFREALRLDPGLYQAYNNIGAMLAHNGMIDR
FT                   AVAEYGRGLSINPDDPELHFNMALALSAREDHGAALKELGEAVRLSPNFAEAHYSLGKT
FT                   LAALDKLDWAVSEYKEALSLDPGLSMAYLDMGVALEESGDLEAAAGAYRDFIKSWKFEY
FT                   GALWEFADRRLNDLEKAPASPPGPRSIYPTAAK"
     MRNAWHKKKW GIMKDIVRAL GLITKGLLVD GRAEEPGAEK ARAYLGRRDY AHAAEELKKA        60
     ISSHPDDPEA HYDLGVALVR AGKLDDAMGS FVAAIKLDPG FAEAHYNLGV VFAKKGMLDD       120
     AIREYNRAAR LRPDYAKAHF NLALALTNKG LHDHAKSELM AVGGIRRRQA LEHYNRGVEL       180
     AGRDEAILSM AEFREALRLD PGLYQAYNNI GAMLAHNGMI DRAVAEYGRG LSINPDDPEL       240
     HFNMALALSA REDHGAALKE LGEAVRLSPN FAEAHYSLGK TLAALDKLDW AVSEYKEALS       300
     LDPGLSMAYL DMGVALEESG DLEAAAGAYR DFIKSWKFEY GALWEFADRR LNDLEKAPAS       360
     PPGPRSIYPT AAK                                                          373
//

If you have problems or comments...

PBIL Back to PBIL home page