(data stored in ACNUC10043 zone)

EMBL: AP011532.PE190

AP011532.PE190       Location/Qualifiers
FT   CDS             184175..185008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0190"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Protein of unknown function DUF63
FT                   family (IPR002749)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0190"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60262"
FT                   /db_xref="GOA:D1YUZ0"
FT                   /db_xref="InterPro:IPR002749"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUZ0"
FT                   /protein_id="BAI60262.1"
FT                   /translation="MDIGSFIAKYYIDPIIYNEGYNVVNTLTYAIILAISLFAILKLMA
FT                   LLRLKIDERLIMAVAPFIILGASLRNLEDVHLLSPPLSYMFITPLVYVLAFLITLAVLL
FT                   ICVYLERAGRVGDYSKPLFWTGVAGVIVVWGTLLLTQPIRVWWAPIVVFALAFTFTGVV
FT                   YLIARYLKLGFLTMPLNVAILGAHMFDASSTFTAIDIVTGFAEKHVVPVFFIDIFGSAF
FT                   VMYALKLAVFIPVIYLIEKYFIEDKDLYYVLKFVLLVLGFGPGIRNTLELVFIHG"
     MDIGSFIAKY YIDPIIYNEG YNVVNTLTYA IILAISLFAI LKLMALLRLK IDERLIMAVA        60
     PFIILGASLR NLEDVHLLSP PLSYMFITPL VYVLAFLITL AVLLICVYLE RAGRVGDYSK       120
     PLFWTGVAGV IVVWGTLLLT QPIRVWWAPI VVFALAFTFT GVVYLIARYL KLGFLTMPLN       180
     VAILGAHMFD ASSTFTAIDI VTGFAEKHVV PVFFIDIFGS AFVMYALKLA VFIPVIYLIE       240
     KYFIEDKDLY YVLKFVLLVL GFGPGIRNTL ELVFIHG                                277
//

If you have problems or comments...

PBIL Back to PBIL home page