(data stored in ACNUC10043 zone)

EMBL: AP011532.PE204

AP011532.PE204       Location/Qualifiers
FT   CDS             200308..201438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0204"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0204"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60276"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV04"
FT                   /protein_id="BAI60276.1"
FT                   /translation="MLPQRLTALAIISLFIMMLIPVALAQSSLTVEEYKYPNGTTVDAM
FT                   CVDSRGNVWLAQSSPATLYRVDPSAGTFDKYVIPTSSDTLFRGMSAEGSSYIWMADEGG
FT                   QQIIGYDVGKNKFYNFTFPLDLNPTDVIAQDNYLWVACNMELGRINMDTNEMKDYYVDR
FT                   YDASLADLAMDRMGNVWFVEYSSGKVGGYSRMDDQVHIFPIPTADSKPTCLGIDSQGRL
FT                   WFLESASSKLGMFDTNLNTFKEIDLPQLDGAQVYAKRLAVDSDDNVWLTDTANGRVIKY
FT                   YTAKDAFVPISLNGTKSYPTLIEADGNTIWAVESGASSLAKIRADPLYGLDATPTPTAT
FT                   PSPTPSATPTPKPTPGFEVIAALCAVCIVARKFNKN"
     MLPQRLTALA IISLFIMMLI PVALAQSSLT VEEYKYPNGT TVDAMCVDSR GNVWLAQSSP        60
     ATLYRVDPSA GTFDKYVIPT SSDTLFRGMS AEGSSYIWMA DEGGQQIIGY DVGKNKFYNF       120
     TFPLDLNPTD VIAQDNYLWV ACNMELGRIN MDTNEMKDYY VDRYDASLAD LAMDRMGNVW       180
     FVEYSSGKVG GYSRMDDQVH IFPIPTADSK PTCLGIDSQG RLWFLESASS KLGMFDTNLN       240
     TFKEIDLPQL DGAQVYAKRL AVDSDDNVWL TDTANGRVIK YYTAKDAFVP ISLNGTKSYP       300
     TLIEADGNTI WAVESGASSL AKIRADPLYG LDATPTPTAT PSPTPSATPT PKPTPGFEVI       360
     AALCAVCIVA RKFNKN                                                       376
//

If you have problems or comments...

PBIL Back to PBIL home page