(data stored in ACNUC10043 zone)

EMBL: AP011532.PE205

AP011532.PE205       Location/Qualifiers
FT   CDS             complement(201435..202304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0205"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Protein of unknown function Met10
FT                   family (IPR003402)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0205"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60277"
FT                   /db_xref="GOA:D1YV05"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030382"
FT                   /db_xref="InterPro:IPR030867"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV05"
FT                   /protein_id="BAI60277.1"
FT                   /translation="MGKNNSKMFNKQRGIPVPADPLATLLKDRLTPEELAVLPRGWQII
FT                   GEVLLIHIPPVLQTKKALIAEALLTLYPRCRTVMETHRIAGEYRQPVFERISGDGTETL
FT                   HKENYVVYKLDVAKIMFSQGNFYERRRMGTVGKGERVVDMFAGIGYFSLPMAVHARPGK
FT                   ILAIELNPESYGYLCENVRLNHVEDIVEPVLGDCREKAPEGWADRAIMGYVGTTQEYLP
FT                   WGIRALKRGGILHYHETTPDKLVFDRPVQNIKDAAKEQGRKAEILEKIKVKKYSPGVWH
FT                   VVVDARIS"
     MGKNNSKMFN KQRGIPVPAD PLATLLKDRL TPEELAVLPR GWQIIGEVLL IHIPPVLQTK        60
     KALIAEALLT LYPRCRTVME THRIAGEYRQ PVFERISGDG TETLHKENYV VYKLDVAKIM       120
     FSQGNFYERR RMGTVGKGER VVDMFAGIGY FSLPMAVHAR PGKILAIELN PESYGYLCEN       180
     VRLNHVEDIV EPVLGDCREK APEGWADRAI MGYVGTTQEY LPWGIRALKR GGILHYHETT       240
     PDKLVFDRPV QNIKDAAKEQ GRKAEILEKI KVKKYSPGVW HVVVDARIS                   289
//

If you have problems or comments...

PBIL Back to PBIL home page