(data stored in ACNUC10043 zone)

EMBL: AP011532.PE207

AP011532.PE207       Location/Qualifiers
FT   CDS             complement(203449..204027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0207"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0207"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60279"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV07"
FT                   /protein_id="BAI60279.1"
FT                   /translation="MVTASKKPKAAPKKAAAKPKAPAKKATASKPKAKPKTTVVKAKTA
FT                   KKTSTPAKAVEARKVGEMVYNDELFESLSEAVLLSEAAAAALLPEIKKQLFDYDIYMVS
FT                   FLGDEDIDEIAEGISKADSAALKPLLAAIRDNARVFVDIASGYNSVRAFIDRSLKSEGK
FT                   DKLKLSFIEGEYCLKGAGPETCESFLMLF"
     MVTASKKPKA APKKAAAKPK APAKKATASK PKAKPKTTVV KAKTAKKTST PAKAVEARKV        60
     GEMVYNDELF ESLSEAVLLS EAAAAALLPE IKKQLFDYDI YMVSFLGDED IDEIAEGISK       120
     ADSAALKPLL AAIRDNARVF VDIASGYNSV RAFIDRSLKS EGKDKLKLSF IEGEYCLKGA       180
     GPETCESFLM LF                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page