(data stored in ACNUC10043 zone)

EMBL: AP011532.PE209

AP011532.PE209       Location/Qualifiers
FT   CDS             complement(205117..205431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0209"
FT                   /product="putative transposase orfA for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0209"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60281"
FT                   /db_xref="GOA:D1YV09"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV09"
FT                   /protein_id="BAI60281.1"
FT                   /translation="MGRVERRRFSREFKLQVLRELKGGKSVAEVCREYDLTRFLVARWK
FT                   REHEENPDAFQGKGKARVDENRTRELERLVGQLYAENDFLKRALANMKKREEDRGRDRI
FT                   "
     MGRVERRRFS REFKLQVLRE LKGGKSVAEV CREYDLTRFL VARWKREHEE NPDAFQGKGK        60
     ARVDENRTRE LERLVGQLYA ENDFLKRALA NMKKREEDRG RDRI                        104
//

If you have problems or comments...

PBIL Back to PBIL home page