(data stored in ACNUC10043 zone)

EMBL: AP011532.PE21

AP011532.PE21        Location/Qualifiers
FT   CDS             complement(14901..15209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0021"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0021"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60093"
FT                   /db_xref="InterPro:IPR012025"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUH1"
FT                   /protein_id="BAI60093.1"
FT                   /translation="MDETWMIFILPETGLQACRMAALAGSAGLRTKQTCFGVLAEGEAG
FT                   AVRGFVGALRRDHDGIYVKRRGFSIEDTEICACTFRFEEGLPPWLARHMGQVKRYTS"
     MDETWMIFIL PETGLQACRM AALAGSAGLR TKQTCFGVLA EGEAGAVRGF VGALRRDHDG        60
     IYVKRRGFSI EDTEICACTF RFEEGLPPWL ARHMGQVKRY TS                          102
//

If you have problems or comments...

PBIL Back to PBIL home page