(data stored in ACNUC10043 zone)

EMBL: AP011532.PE212

AP011532.PE212       Location/Qualifiers
FT   CDS             207248..209191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0212"
FT                   /product="ferrous iron transport protein B"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0212"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60284"
FT                   /db_xref="GOA:D1YV12"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV12"
FT                   /protein_id="BAI60284.1"
FT                   /translation="MKPVKVARPIKVARPIKVALIGNPTVGKSSLFSRLTGIGVIISNY
FT                   PGTTVEVAHGRVAHDGVSLDLSDLPGVYSLDTASSEERTVLDFLRDERPDVILNVVDST
FT                   RLERNLYLTLEVLELGLPVVVALNMVEEAHAQGMDIDAEALSRVLGVPVIPTYIHRGAG
FT                   LEELTHALFHPRLLKPRLTRYDRHVEAFIRQLMGMQLGLTRYEAIRLLSNAPEASKYPE
FT                   GIRTAAEMMRKEVEQSHNEPIGDILAGNRYAEAGLIAKGVARQRQPSPEATLRERIDDL
FT                   LMSPLSGFLILALAILGMLLIVFLVGGFLEDIIVGAMETYVISPVSGALVTHPLVLVIV
FT                   KYTLIGIQAGLGIVIPYIMTFYLLMAVLENSGYLTRAAFLLDEVMHKFRLHGRAMIPLI
FT                   LGFGCSVPAIMSTKALQTKRERIVTSAMVCMVPCSARSVVIMGLVASFVSIPAALSIYL
FT                   LMILITIAMGYVLGRTVKGEEMGFVMEMVPLRVPQVKDILDKTWMQMKEFIYVAFPLLI
FT                   AGSAVLGVLQYAGILDVVNGLLAPVTTGILGLPPYTATALIFGVLRKEMALETLAVLAG
FT                   TAQFNTVFTALQMYVFGVFTTIYMPCIATVTMLNRVVGLKDTILITGLTFLLALVISGL
FT                   IANLVPLLAALI"
     MKPVKVARPI KVARPIKVAL IGNPTVGKSS LFSRLTGIGV IISNYPGTTV EVAHGRVAHD        60
     GVSLDLSDLP GVYSLDTASS EERTVLDFLR DERPDVILNV VDSTRLERNL YLTLEVLELG       120
     LPVVVALNMV EEAHAQGMDI DAEALSRVLG VPVIPTYIHR GAGLEELTHA LFHPRLLKPR       180
     LTRYDRHVEA FIRQLMGMQL GLTRYEAIRL LSNAPEASKY PEGIRTAAEM MRKEVEQSHN       240
     EPIGDILAGN RYAEAGLIAK GVARQRQPSP EATLRERIDD LLMSPLSGFL ILALAILGML       300
     LIVFLVGGFL EDIIVGAMET YVISPVSGAL VTHPLVLVIV KYTLIGIQAG LGIVIPYIMT       360
     FYLLMAVLEN SGYLTRAAFL LDEVMHKFRL HGRAMIPLIL GFGCSVPAIM STKALQTKRE       420
     RIVTSAMVCM VPCSARSVVI MGLVASFVSI PAALSIYLLM ILITIAMGYV LGRTVKGEEM       480
     GFVMEMVPLR VPQVKDILDK TWMQMKEFIY VAFPLLIAGS AVLGVLQYAG ILDVVNGLLA       540
     PVTTGILGLP PYTATALIFG VLRKEMALET LAVLAGTAQF NTVFTALQMY VFGVFTTIYM       600
     PCIATVTMLN RVVGLKDTIL ITGLTFLLAL VISGLIANLV PLLAALI                     647
//

If you have problems or comments...

PBIL Back to PBIL home page