(data stored in ACNUC10043 zone)

EMBL: AP011532.PE22

AP011532.PE22        Location/Qualifiers
FT   CDS             complement(15211..15567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0022"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0022"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60094"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUH2"
FT                   /protein_id="BAI60094.1"
FT                   /translation="MGWEFDKEELCFNCRSQAIQRIKVLSRELLTQCTNCGAEAHYALH
FT                   GAYQEKKMPELIGSDVGEALGAWCFCHEALCPNCSSETTNEVLIDTVMAMIACEKCLLT
FT                   RLYRFDAFDKSWRR"
     MGWEFDKEEL CFNCRSQAIQ RIKVLSRELL TQCTNCGAEA HYALHGAYQE KKMPELIGSD        60
     VGEALGAWCF CHEALCPNCS SETTNEVLID TVMAMIACEK CLLTRLYRFD AFDKSWRR         118
//

If you have problems or comments...

PBIL Back to PBIL home page