(data stored in ACNUC10043 zone)

EMBL: AP011532.PE231

AP011532.PE231       Location/Qualifiers
FT   CDS             228471..229256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0231"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Protein of unknown function DUF849,
FT                   prokaryotic family (IPR008567)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0231"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60303"
FT                   /db_xref="GOA:D1YV31"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV31"
FT                   /protein_id="BAI60303.1"
FT                   /translation="MVPTRKDSPYVPLTPEEIAEDTYRAYKLGVSSVHVHARDEAGNPT
FT                   YKKEVYGEIFSAIRRKCPDIIICASTSGRSDRSLEHRAEVLELRPDMASLMMGTVNFIK
FT                   NPSPNSQEDIVALAKRMEEHGVKPELEAFEPGFVNVAKYLASKGHLRPPLHFNLLLGSL
FT                   GSMPAEARDLVFLAGSVPPGSTWAATGIGRFQLQVNVASMLMGGHVRVGLEDSLYYSYP
FT                   EKSLATNEQLVERVARIARELGREIATPAEARAILGLDH"
     MVPTRKDSPY VPLTPEEIAE DTYRAYKLGV SSVHVHARDE AGNPTYKKEV YGEIFSAIRR        60
     KCPDIIICAS TSGRSDRSLE HRAEVLELRP DMASLMMGTV NFIKNPSPNS QEDIVALAKR       120
     MEEHGVKPEL EAFEPGFVNV AKYLASKGHL RPPLHFNLLL GSLGSMPAEA RDLVFLAGSV       180
     PPGSTWAATG IGRFQLQVNV ASMLMGGHVR VGLEDSLYYS YPEKSLATNE QLVERVARIA       240
     RELGREIATP AEARAILGLD H                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page