(data stored in ACNUC10043 zone)

EMBL: AP011532.PE235

AP011532.PE235       Location/Qualifiers
FT   CDS             235704..236831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0235"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0235"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60307"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV35"
FT                   /protein_id="BAI60307.1"
FT                   /translation="MDASRTDIVCFSDIFWDFVWQRHQSLLTRFPEGWNILFVEPTSLV
FT                   VLLKEPRRLLARKHGNITVISSPALPLTDKVSILRPVNDIFIWCWLKAMFLKHNITRPV
FT                   LLYYAPRFSSLIGRLGERLATYDCADDRMAFSREPHWMGPYVENLFKKSGIVFVTSESL
FT                   RKKALGYRSDNVHLIGNGVDAGLFEKAWGDVPVPDDIKWLKKPIIGYFGVIDEWMDIDL
FT                   IVRMASAYPEASIVLVGPALIGPEGLQKLKSLPNVYLPGQKPHDALPGYLKAFDVCIIP
FT                   FRINELTKSVNPVKLYEYLAGGKNVVTITMAEVEKYDGTIYIARDHDDFIRKTADALRN
FT                   KPDADRMKAVVSENTWDSKAKAMVEIIQRSIDTHG"
     MDASRTDIVC FSDIFWDFVW QRHQSLLTRF PEGWNILFVE PTSLVVLLKE PRRLLARKHG        60
     NITVISSPAL PLTDKVSILR PVNDIFIWCW LKAMFLKHNI TRPVLLYYAP RFSSLIGRLG       120
     ERLATYDCAD DRMAFSREPH WMGPYVENLF KKSGIVFVTS ESLRKKALGY RSDNVHLIGN       180
     GVDAGLFEKA WGDVPVPDDI KWLKKPIIGY FGVIDEWMDI DLIVRMASAY PEASIVLVGP       240
     ALIGPEGLQK LKSLPNVYLP GQKPHDALPG YLKAFDVCII PFRINELTKS VNPVKLYEYL       300
     AGGKNVVTIT MAEVEKYDGT IYIARDHDDF IRKTADALRN KPDADRMKAV VSENTWDSKA       360
     KAMVEIIQRS IDTHG                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page